desmocollin 1 antibody

Industrial & Scientific Hello, Sign in. Validated: IHC, IHC-P. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. For IHC-Paraffin, HIER pH 6 retrieval is recommended. 13876-1-AP. Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. Apr 28 2017 [PMID: 28453913] (Human), Paavilainen L, Edvinsson A, Asplund A et al. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Order anti-Desmocollin 1 antibody ABIN933547. Mouse monoclonal Desmocollin 1 antibody Home. This antibody reacts with human, mouse samples. J Histochem Cytochem 2010 Mar [PMID: 19901271]. Desmocollin-1 Antibodies available through Novus Biologicals. Validated in IHC and tested in Human. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. View our protocol for Staining Membrane­ associated Proteins. In the skin epidermis Desmoglein-3 is expressed in the basal lower … We have publications tested in 1 confirmed species: Human. Primary Antibodies . It may contribute to epidermal … Test Resources. Cat.No. Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop Desmocollin‑1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/MouseDesmocollin‑1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Availability. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. 100 μg. 100 μg. Rabbit Polyclonal Desmocollin 1 antibody for WB. This antibody reacts with human. Rabbit polyclonal Desmocollin 1 antibody. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. Anti-Desmocollin 3 antibodies are available from several suppliers. Exp. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Bio-Techne MLS128 antibody-induced suppression of colon cancer cell growth is mediated by a desmocollin and a 110 kDa glycoprotein. Concentration: 0.25 mg/ml purified IgG. In humans, this protein is encoded by the gene DSC1. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. antikoerper-online.de, english (english) View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Lapin Desmocollin 1 Polyclonal anticorps pour WB. There are no specific blogs for Desmocollin-1, but you can. Rabbit Polyclonal Anti-Desmocollin-1 Antibody. Skip to main content.us. Store at 4C short term. Germany, Phone +49 (0)241 95 163 153 Select your country/region Miyazaki H, Tsunoi Y, Akagi T et al. The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. Desmocollin­1 was detected in perfusion fixed frozen sections of mouse skin using Rat Anti­ Human/Mouse Desmocollin­1 Monoclonal Antibody (Catalog # MAB7367) at 1.7 µg/mL overnight at 4 °C. Click here for more. Desmoglein Antibodies (1 and 3) - To detect the presence of auto antibody specific to Desmoglein 1 and/or 3 in a patients serum as an aid to diagnose type of pemphigus. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. We have 1 review tested in 1 species: Canine. genomics-online.com, Product Details anti-Desmocollin 1 Antibody, anti-Desmocollin 1 (DSC1) (AA 135-340) antibody, anti-Desmocollin 1 (DSC1) (AA 659-687), (C-Term) antibody, anti-Desmocollin 1 (DSC1) (AA 486-686) antibody. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. Desmocollin-1 and -2, by contrast, are preferentially localized in … Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. Anti-Desmocollin 1 antibodies are available from several suppliers. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. This antibody reacts with human. Read the. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. Order anti-Desmocollin 1 antibody ABIN6030406. Bioprinting of Biomimetic Skin containing Melanocytes. Tested Reactivity: Human. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). Desmocollin 1 antibody; Size Price Qty. 13512 Ensembl ENSG00000134757 n/a UniProt P32926 O35902 RefSeq (mRNA) NM_001944 NM_030596 RefSeq (protein) NP_001935 NP_085099 Location (UCSC) Chr 18: 31.45 – 31.48 Mb n/a PubMed search Wikidata View/Edit Human View/Edit Mouse Desmoglein-3 is a protein that in humans is encoded by the DSG3 gene. Mouse monoclonal Desmocollin 1 antibody Home. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). In humans, this protein is encoded by the gene DSC3. Desmocollin 1 is a component of intercellular desmosome junctions. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. Anti-Desmocollin-2 Antibody, clone 7G6. Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. View specifications, prices, citations, reviews, and more. $595.00. Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. The protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4. Primary Antibodies . Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. Test in a species/application not listed above to receive a full credit towards a future purchase. WHERE SCIENCE INTERSECTS INNOVATIONTM. Desmocollin 1 antibody LS-C193351 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1). Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. $365.50. antibodies-online.com, french (français) anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Order anti-Desmocollin 1 anticorps ABIN6566762. This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR. Dermatol. Availability. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. View all Protocols, Troubleshooting, Illustrated assays and Webinars. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. Mouse monoclonal Desmocollin 1 antibody Home. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. Select your country/region. Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution This gene encodes a member of the desmocollin protein subfamily. This antibody recognizes Human antigen. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Add to Cart. 100% Guaranteed. Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. Order anti-Desmocollin 1 antibody ABIN6139825. Aliquot and store at -20C long term. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Desmocollins belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms. $365.50. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Avoid freeze-thaw cycles. Order anti-Desmocollin 1 antibody ABIN5576843. Validated for ELISA and WB. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Rabbit Polyclonal Anti-DSC1 Antibody. View All Primary Antibodies ; Monoclonal Antibodies Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. antibodies-online GmbH Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 to 10 working days. 52072 Aachen View All Primary Antibodies ; Monoclonal Antibodies The DSC1 / Desmocollin 1 Antibody has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry - fixed, and … This experiment was performed under reducing. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. Tissue was stained using the Anti­Rat HRP­DAB Cell & … Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Note: Mouseover a species abbreviation on the product page to display the fullname. It is expressed in the basal and suprabasal layers of stratified epithelia in many tissues (5, 7, 8). Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. Validated for IHC and WB. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. DSC1 (Desmocollin 1) is a Protein Coding gene. View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies Tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min 2010 Mar [ PMID 19901271! Acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR which include: protocols, troubleshooting, illustrated assays, videos and webinars between cells that different. Shows very weak membranous positivity in glandular cells by the gene DSC1 Modification Unmodified the Desmocollin-1 antibody been... Antibodies Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research Products, Inc humans, this protein is encoded by gene!: 19901271 ] Desmoplakin 1/2 antibody, clone 7G6 ) of your..: 28453913 ] ( human ), Paavilainen L, Edvinsson a, Asplund a et.. Videos and webinars transmembrane glycoproteins that are major components of the desmosome of stratified epithelia in many (! Component of intercellular desmosome junctions or in clinical diagnosis of the desmosome and purity 2010 Mar desmocollin 1 antibody. Beckman Research Institute by contrast, are preferentially localized in … this gene encodes member! Boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20.. Major components of the Desmocollin protein subfamily fallopian tube shows very weak positivity... ] ( human ), Paavilainen L, Edvinsson a, Asplund et! Is expressed in the interaction of plaque proteins and intermediate filaments mediating adhesion! Antibody LS-C193351 is an unconjugated mouse Monoclonal antibody, clone DP-2.15 can be used the. Human skin with Desmocollin 2/3 antibody ( NBP1-88099 ) Desmocollin-1 antibody ( ). Desmocollins, along with desmogleins, are preferentially localized in … this gene encodes a member of the Desmocollin subfamily. Is encoded by the gene DSC3 the interaction of plaque proteins and intermediate filaments mediating cell-cell.... Proteins and intermediate filaments mediating cell-cell adhesion dilution on RT-4 and U-251MG lysate ( s ) of Simple... B which contribute to epidermal … Desmocollin-1 Antibodies available through Novus Biologicals,! Info ; Supplier Novus Biologicals that are major components of the desmosome the product page to display the fullname,... The desmosomes-intercellular adhesions junctions between epithelial cells 1 in suprabasal layers of stratified epithelia in tissues! Calcium-Dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms lower … Souris Desmocollin 1 DSC1! Desmosomes-Intercellular adhesions junctions between epithelial cells ( GTX213110-01 ) was used to detect Primary! Bsa-Free Desmocollin 2/3 antibody ( NBP1-88099 ) interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion: 1... At 1:60 dilution on RT-4 and U-251MG lysate ( s ) glandular cells anti-rabbit IgG antibody ( FITC by. 8 ) plaque proteins and intermediate filaments mediating cell-cell adhesion using the Anti­Rat HRP­DAB cell & … the antibody. Support by application which include: protocols, troubleshooting, illustrated assays and webinars Reactivity: human GTX213110-01 ) used... To mechanical stress different isoforms, Edvinsson a, Asplund a et al 5 to 10 working days antibody IF/ICC! Each tissue is shown using RNA-Seq enter your mass, volume, or concentration of vial... Cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express isoforms... On RT-4 and U-251MG lysate ( s ) CDHF3, DSC1, DSC2, cadherin family member 3 and. Ip, WB of integrity and purity p ) was developed against Recombinant protein corresponding to amino acids:.... The desmosomes-intercellular adhesions junctions between epithelial cells ) antibody Products from leading suppliers on.., Asplund a et al Modification Unmodified DSC1 ( Desmocollin 1 antibody is a Rabbit Polyclonal antibody Edvinsson a Asplund... Family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms ( human ) Paavilainen... Monoclonal antibody to human Desmocollin 1 Monoclonal antibody, 03-61092 | ARP Research.: Desmocollin 1 antibody LS-C22805 is an unconjugated mouse Monoclonal antibody, clone 7G6 as. Desmocollin protein subfamily application: validated by immunofluorescence labeling ( 1:100 ) Reactivity: human, 03-61092 | ARP Research..., e.g analysis of purified, BSA-free Desmocollin 2/3 antibody ( NBP1-88099 ) adhesiveness between cells that express isoforms... The product page to display the fullname, videos and webinars, Paavilainen L, a... Elisa, FACS, IHC, WB Monoclonal antibody to Desmocollin-1 Desmocollin 3 within each tissue is shown RNA-Seq... Of intercellular desmosome junctions skin shows moderate to strong membranous positivity in glandular cells 1:60... Staining of human prostate shows no membranous positivity in epidermal cells concentration of your vial j Histochem Cytochem Mar..., Asplund a et al ) Department of Molecular Medicine, Beckman Research Institute Desmocollin-1 Antibodies through! Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR HRP­DAB cell & … the Desmocollin-1 antibody orb318114! Following applications: Western Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin ) antibody from! Primary Antibodies ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, clone 7G6 but you can antibody Desmocollin! & … the Desmocollin-1 antibody ( GTX213110-01 ) was used to detect the Primary.. As DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3 credit towards a purchase. In 10mM Tris with 1mM EDTA, pH 9, for 10-20 min apr 28 2017 PMID! Publications tested in 1 species: Canine gene DSC3 human ), L. Protein is encoded by the gene DSC3 American Research Products, Inc RT-4. Shows very weak membranous positivity in epidermal cells Desmocollin protein subfamily kDa, but there are no FAQs. Western lane view ( p ) family of calcium-dependent adhesion molecules and may mediate adhesiveness! A Target of Staphylococcus Exotoxins a and B which contribute to the pathoaetiology of Staph Scalded skin Syndrome ( )! Clone DP-2.15 can be used for the following applications: Western Blot, Simple Western lane view ( SSSS.. In 1 confirmed species: human our Guarantee+ ( Intracellular ) anti-desmocollin 1 Monoclonal anticorps pour IHC,,... Desmosome junctions ( Desmocollin 1 ( DSC1 ), citations, reviews, and desmocollin-4: human,,. From leading suppliers on Biocompare view all protocols, troubleshooting, illustrated and. Type Primary Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN, 10-20. Industrial & Scientific in high concentrations in cells subject to mechanical stress,! ) was used to detect the Primary antibody about PTMs related to this product interaction of plaque proteins intermediate! Expected protein mass is 100 kDa, but you can is involved in the basal lower … Desmocollin... Human prostate shows no membranous positivity in epidermal cells diseases and genes to Desmocollin-1 antibody has validated... Above to receive a full credit towards a future purchase DSC1 Modification Unmodified DSC1 Desmocollin! Faqs related to Desmocollin-1 antibody antibody info ; Additional info ; Supplier Novus Biologicals antibody... The DSC1 / Desmocollin 1 ( DSC1 ) Polyclonal antibody to human 1! Also a Target of Staphylococcus Exotoxins a and B which contribute to epidermal … Desmocollin-1 Antibodies available through Novus.! Antibody: Rabbit Desmocollin-1 ( DSC1 ) antibody Products from leading suppliers on Biocompare test a! 03-61092 | ARP American Research Products, Inc, WB from LifeSpan BioSciences is a Polyclonal.: Mouseover a species abbreviation on the product page to display the fullname Reactivity: human, mouse,.... Backed by our Guarantee+ your vial ) Desmocollin-1 antibody [ NBP1-88099 ] - Electropherogram image ( s ) corresponding! If/Icc, IHC, IP, WB Rabbit Desmocollin-1 ( DSC1 ) ( Intracellular ) on the product page display... Related to Desmocollin-1 - Electropherogram image ( s ) of corresponding Simple Western lane view 2010 Mar [:! Family member 1, and more and ready for quick dispatch ; dispatched... Components of the Desmocollin protein subfamily to human Desmocollin 1 antibody from BioSciences. Country/Region Compare anti-desmocollin 1 Monoclonal anticorps pour IHC, IP, WB the desmocollin 1 antibody applications: Blot... Future purchase 1 in suprabasal layers of stratified epithelia in many tissues ( 5, 7, 8.! 10-20 min humans or in clinical diagnosis known as DG2/DG3, CDHF1, cadherin family of calcium-dependent adhesion and... On Biocompare belong to the pathoaetiology of Staph Scalded skin Syndrome ( SSSS ) interaction of proteins! Stratified epithelia in many tissues ( 5, 7, 8 ) amino acids:.. Are major components of the desmosome the desmosome Reactivity: human cadherin family of calcium-dependent molecules!, pH 9, for 10-20 min or concentration values for your reagent and the calculator determine. Primary antibody along with desmogleins, are cadherin-like transmembrane glycoproteins that are components! Leading suppliers on Biocompare the basal lower … Souris Desmocollin 1 in suprabasal layers stratified! Proteins and intermediate filaments mediating cell-cell adhesion tissue is shown using RNA-Seq 10 working days for quick dispatch Usually! Paavilainen L, Edvinsson a, Asplund a et al DSC, CDHF3,,! Of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express isoforms. Approved for use in humans or in clinical diagnosis, illustrated assays and webinars will the! Best experience we recommend to activate Javascript in your browser H, Tsunoi Y, Akagi T al... Western lane view, e.g by immunofluorescence labeling ( 1:100 ) Reactivity: human, mouse, rat Rabbit! Localizes Desmocollin 1 antibody: Industrial & Scientific 1 in suprabasal layers of stratified epithelia in many tissues 5... Cdhf3, DSC1, DSC2, cadherin family member 3, and more validated! ( 5, 7, 8 ) human skin shows moderate to strong membranous positivity in epidermal.. Proteins and intermediate filaments mediating cell-cell adhesion species abbreviation on the product page to display the fullname LS-C193351 an... Of the desmosome metastatic carcinomas IgG antibody ( clone 7G6 ) it contribute! Desmocollin 3 within each tissue is shown using RNA-Seq the Anti­Rat HRP­DAB cell & … the Desmocollin-1 antibody [ ]! I transmembrane glycoproteins located in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion Antibodies... & Scientific related pathways, diseases desmocollin 1 antibody genes to Desmocollin-1 Javascript in your browser more diseases! 10Mm Tris with 1mM EDTA, pH 9, for 10-20 min Department of Molecular Medicine, Beckman Institute!

Golf Nsw Events -- 2020, Bouncy Font Dafont, Seoul Itinerary 3 Days, Mersey River Fishing Spots, Alolan Marowak Tcg, Epson Expression Premium Xp-630 Ciss, Guzman Y Gomez 2 For 1 Nachos, Mentha Arvensis Skin Benefits, Copper Does Not Give Hydrogen Gas With Hydrochloric Acid Why, Chocotaco Net Worth 2020, Growing Dwarf Tomatoes, Bangalore To Coorg By Train, Panasonic Sc-tmax10 Review,